SCOP 1.69: Domain d1ul5a_: 1ul5 A:

Lineage for d1ul5a_ (1ul5 A:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.72: SBT domain [103611] (1 superfamily)
   consist of two different zn-binding subdomains, each subdomain resembles a distorted glucocorticoid receptor-like fold

4. Superfamily g.72.1: SBT domain [103612] (1 family)

5. Family g.72.1.1: SBT domain [103613] (2 proteins)
   Pfam 03110

6. Protein Squamosa promoter binding protein-like 7, DNA-binding domain [103616] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103617] (1 PDB entry)

8. Domain d1ul5a_: 1ul5 A: [99539]

Details for d1ul5a_

PDB Entry: 1ul5

PDB Description: solution structure of the dna-binding domain of squamosa promoter binding protein-like 7

SCOP Domain Sequences for d1ul5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ul5a_ g.72.1.1 (A:) Squamosa promoter binding protein-like 7, DNA-binding domain {Thale cress (Arabidopsis thaliana)}
varcqvpdceadiselkgyhkrhrvclrcatasfvvldgenkrycqqcgkfhllpdfdeg
krscrrklerhnnrrkrkpvdkggva

Timeline for d1ul5a_:

• d1ul5a_ first appeared in SCOP 1.67
  
• d1ul5a_ appears in SCOP 1.71
  
• d1ul5a_ appears in the current release, SCOPe 2.08