Lineage for d1ul4a_ (1ul4 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643296Fold g.72: SBT domain [103611] (1 superfamily)
    consist of two different zn-binding subdomains, each subdomain resembles a distorted glucocorticoid receptor-like fold
  4. 2643297Superfamily g.72.1: SBT domain [103612] (1 family) (S)
    automatically mapped to Pfam PF03110
  5. 2643298Family g.72.1.1: SBT domain [103613] (3 proteins)
    Pfam PF03110
  6. 2643299Protein Squamosa promoter binding protein-like 4, DNA-binding domain [103614] (1 species)
  7. 2643300Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103615] (1 PDB entry)
  8. 2643301Domain d1ul4a_: 1ul4 A: [99538]
    complexed with zn

Details for d1ul4a_

PDB Entry: 1ul4 (more details)

PDB Description: Solution structure of the DNA-binding domain of squamosa promoter binding protein-like 4
PDB Compounds: (A:) squamosa promoter binding protein-like 4

SCOPe Domain Sequences for d1ul4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ul4a_ g.72.1.1 (A:) Squamosa promoter binding protein-like 4, DNA-binding domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lrlcqvdrctadmkeaklyhrrhkvcevhakassvflsglnqrfcqqcsrfhdlqefdea
krscrrrlaghnerrrkssge

SCOPe Domain Coordinates for d1ul4a_:

Click to download the PDB-style file with coordinates for d1ul4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ul4a_: