Lineage for d1ul4a_ (1ul4 A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 525019Fold g.72: SBT domain [103611] (1 superfamily)
    consist of two different zn-binding subdomains, each subdomain resembles a distorted glucocorticoid receptor-like fold
  4. 525020Superfamily g.72.1: SBT domain [103612] (1 family) (S)
  5. 525021Family g.72.1.1: SBT domain [103613] (2 proteins)
    Pfam 03110
  6. 525022Protein Squamosa promoter binding protein-like 4, DNA-binding domain [103614] (1 species)
  7. 525023Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103615] (1 PDB entry)
  8. 525024Domain d1ul4a_: 1ul4 A: [99538]

Details for d1ul4a_

PDB Entry: 1ul4 (more details)

PDB Description: Solution structure of the DNA-binding domain of squamosa promoter binding protein-like 4

SCOP Domain Sequences for d1ul4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ul4a_ g.72.1.1 (A:) Squamosa promoter binding protein-like 4, DNA-binding domain {Thale cress (Arabidopsis thaliana)}
lrlcqvdrctadmkeaklyhrrhkvcevhakassvflsglnqrfcqqcsrfhdlqefdea
krscrrrlaghnerrrkssge

SCOP Domain Coordinates for d1ul4a_:

Click to download the PDB-style file with coordinates for d1ul4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ul4a_: