Lineage for d1ul3d_ (1ul3 D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603695Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 603696Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)
  6. 603697Protein PII (product of glnB) [54915] (5 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 603702Species Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId:1131] [102971] (1 PDB entry)
  8. 603706Domain d1ul3d_: 1ul3 D: [99537]
    complexed with ca, gol

Details for d1ul3d_

PDB Entry: 1ul3 (more details), 2 Å

PDB Description: Crystal Structure of PII from Synechocystis sp. PCC 6803

SCOP Domain Sequences for d1ul3d_:

Sequence, based on SEQRES records: (download)

>d1ul3d_ d.58.5.1 (D:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803}
mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdte

Sequence, based on observed residues (ATOM records): (download)

>d1ul3d_ d.58.5.1 (D:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803}
mkkveaiirpfkldevkialvnagivgmtvsevrgfgreflqklkieivvdegqvdmvvd
klvsaartgeigdgkifispvdsvvrirtgekdte

SCOP Domain Coordinates for d1ul3d_:

Click to download the PDB-style file with coordinates for d1ul3d_.
(The format of our PDB-style files is described here.)

Timeline for d1ul3d_: