Lineage for d1ul3a_ (1ul3 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. Species Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId:1131] [102971] (1 PDB entry)
  8. Domain d1ul3a_: 1ul3 A: [99534]
    complexed with ca, gol

Details for d1ul3a_

PDB Entry: 1ul3 (more details), 2 Å

PDB Description: Crystal Structure of PII from Synechocystis sp. PCC 6803
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1ul3a_:

Sequence, based on SEQRES records: (download)

>d1ul3a_ d.58.5.1 (A:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId: 1131]}
mkkveaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
ieivvdegqvdmvvdklvsaartgeigdgkifispvdsvvrirtgekdteai

Sequence, based on observed residues (ATOM records): (download)

>d1ul3a_ d.58.5.1 (A:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc pcc 6803 [TaxId: 1131]}
mkkveaiirpfkldevkialvnagivgmtvsevrgfeflqklkieivvdegqvdmvvdkl
vsaartgeigdgkifispvdsvvrirtgekdteai

SCOPe Domain Coordinates for d1ul3a_ are not available.

Timeline for d1ul3a_:

Domains from other chains:
(mouse over for more information)
d1ul3b_, d1ul3c_, d1ul3d_