| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (4 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins) |
| Protein Cut A1 [89931] (4 species) |
| Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102974] (2 PDB entries) |
| Domain d1ukua_: 1uku A: [99533] |
PDB Entry: 1uku (more details), 1.45 Å
SCOP Domain Sequences for d1ukua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukua_ d.58.5.2 (A:) Cut A1 {Archaeon Pyrococcus horikoshii }
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
Timeline for d1ukua_: