Lineage for d1ukua_ (1uku A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412166Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 412197Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 412198Protein Cut A1 [89931] (4 species)
  7. 412201Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102974] (2 PDB entries)
  8. 412202Domain d1ukua_: 1uku A: [99533]
    complexed with cu

Details for d1ukua_

PDB Entry: 1uku (more details), 1.45 Å

PDB Description: Crystal Structure of Pyrococcus horikoshii CutA1 Complexed with Cu2+

SCOP Domain Sequences for d1ukua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukua_ d.58.5.2 (A:) Cut A1 {Archaeon Pyrococcus horikoshii }
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

SCOP Domain Coordinates for d1ukua_:

Click to download the PDB-style file with coordinates for d1ukua_.
(The format of our PDB-style files is described here.)

Timeline for d1ukua_: