Lineage for d1uktb4 (1ukt B:1-406)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384383Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 384554Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 384564Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 384583Domain d1uktb4: 1ukt B:1-406 [99532]
    Other proteins in same PDB: d1ukta1, d1ukta2, d1ukta3, d1uktb1, d1uktb2, d1uktb3
    complexed with aci, ca, glb, glc, gld; mutant

Details for d1uktb4

PDB Entry: 1ukt (more details), 2.2 Å

PDB Description: crystal structure of y100l mutant cyclodextrin glucanotransferase compexed with an acarbose

SCOP Domain Sequences for d1uktb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uktb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhglwardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1uktb4:

Click to download the PDB-style file with coordinates for d1uktb4.
(The format of our PDB-style files is described here.)

Timeline for d1uktb4: