Lineage for d1uktb2 (1ukt B:582-686)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364770Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2364771Family b.3.1.1: Starch-binding domain [49453] (3 protein domains)
    automatically mapped to Pfam PF00686
  6. 2364804Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2364805Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 2364841Domain d1uktb2: 1ukt B:582-686 [99530]
    Other proteins in same PDB: d1ukta1, d1ukta3, d1ukta4, d1uktb1, d1uktb3, d1uktb4
    complexed with aci, ca, gal, glc, gld; mutant

Details for d1uktb2

PDB Entry: 1ukt (more details), 2.2 Å

PDB Description: crystal structure of y100l mutant cyclodextrin glucanotransferase compexed with an acarbose
PDB Compounds: (B:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1uktb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uktb2 b.3.1.1 (B:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvs
vpagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOPe Domain Coordinates for d1uktb2:

Click to download the PDB-style file with coordinates for d1uktb2.
(The format of our PDB-style files is described here.)

Timeline for d1uktb2: