Lineage for d1uktb1 (1ukt B:496-581)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)
  8. Domain d1uktb1: 1ukt B:496-581 [99529]
    Other proteins in same PDB: d1ukta2, d1ukta3, d1ukta4, d1uktb2, d1uktb3, d1uktb4
    complexed with aci, ca; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1uktb1

PDB Entry: 1ukt (more details), 2.2 Å

PDB Description: crystal structure of y100l mutant cyclodextrin glucanotransferase compexed with an acarbose
PDB Compounds: (B:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1uktb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uktb1 b.1.18.2 (B:496-581) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]}
attpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipa
vpggiydirvanaagaasniydnfev

SCOPe Domain Coordinates for d1uktb1 are not available.

Timeline for d1uktb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uktb2, d1uktb3, d1uktb4
View in 3D
Domains from other chains:
(mouse over for more information)
d1ukta1, d1ukta2, d1ukta3, d1ukta4