Lineage for d1ukpb_ (1ukp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830026Protein beta-Amylase [51481] (3 species)
    Common fold covers whole protein structure
  7. 2830029Species Soybean (Glycine max) [TaxId:3847] [51482] (18 PDB entries)
    Uniprot P10538
  8. 2830041Domain d1ukpb_: 1ukp B: [99506]
    complexed with so4; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1ukpb_

PDB Entry: 1ukp (more details), 2.1 Å

PDB Description: crystal structure of soybean beta-amylase mutant substituted at surface region
PDB Compounds: (B:) beta-amylase

SCOPe Domain Sequences for d1ukpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukpb_ c.1.8.1 (B:) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]}
nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag
elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
vlsggwreyirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
lqksnfnifkkfvlkmhadqdycanpqkynhaitplspsapkipievlleatkptrpfpw
ldetdmkvdg

SCOPe Domain Coordinates for d1ukpb_:

Click to download the PDB-style file with coordinates for d1ukpb_.
(The format of our PDB-style files is described here.)

Timeline for d1ukpb_: