Lineage for d1uklf_ (1ukl F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996289Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 1996290Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 1996291Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 1996328Protein SREBP-2 [101171] (1 species)
  7. 1996329Species Human (Homo sapiens) [TaxId:9606] [101172] (1 PDB entry)
  8. 1996333Domain d1uklf_: 1ukl F: [99498]
    Other proteins in same PDB: d1ukla_, d1uklb_
    complexed with importin-beta
    protein/DNA complex

Details for d1uklf_

PDB Entry: 1ukl (more details), 3 Å

PDB Description: Crystal structure of Importin-beta and SREBP-2 complex
PDB Compounds: (F:) Sterol regulatory element binding protein-2

SCOPe Domain Sequences for d1uklf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uklf_ a.38.1.1 (F:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]}
rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk
l

SCOPe Domain Coordinates for d1uklf_:

Click to download the PDB-style file with coordinates for d1uklf_.
(The format of our PDB-style files is described here.)

Timeline for d1uklf_: