Lineage for d1ukle_ (1ukl E:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355126Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 355127Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) (S)
    dimer of two identical helix-loop-helix subunits
  5. 355128Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 355166Protein SREBP-2 [101171] (1 species)
  7. 355167Species Human (Homo sapiens) [TaxId:9606] [101172] (1 PDB entry)
  8. 355170Domain d1ukle_: 1ukl E: [99497]
    Other proteins in same PDB: d1ukla_, d1uklb_

Details for d1ukle_

PDB Entry: 1ukl (more details), 3 Å

PDB Description: Crystal structure of Importin-beta and SREBP-2 complex

SCOP Domain Sequences for d1ukle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukle_ a.38.1.1 (E:) SREBP-2 {Human (Homo sapiens)}
rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk
l

SCOP Domain Coordinates for d1ukle_:

Click to download the PDB-style file with coordinates for d1ukle_.
(The format of our PDB-style files is described here.)

Timeline for d1ukle_: