SCOPe 2.07: Domain d1uklc_: 1ukl C:

Lineage for d1uklc_ (1ukl C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (9 proteins)

6. Protein SREBP-2 [101171] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101172] (1 PDB entry)

8. Domain d1uklc_: 1ukl C: [99495]
   Other proteins in same PDB: d1ukla_, d1uklb_
   complexed with importin-beta
   protein/DNA complex

Details for d1uklc_

PDB Entry: 1ukl, 3 Å

PDB Description: Crystal structure of Importin-beta and SREBP-2 complex

PDB Compounds: (C:) Sterol regulatory element binding protein-2

SCOPe Domain Sequences for d1uklc_:

Sequence; same for both SEQRES and ATOM records:

>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]}
rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk
l

Timeline for d1uklc_:

• d1uklc_ first appeared in SCOP 1.67
  
• d1uklc_ appears in SCOPe 2.06
  
• d1uklc_ appears in the current release, SCOPe 2.08