![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
![]() | Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family) ![]() dimer of two identical helix-loop-helix subunits |
![]() | Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins) |
![]() | Protein SREBP-2 [101171] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101172] (1 PDB entry) |
![]() | Domain d1uklc_: 1ukl C: [99495] Other proteins in same PDB: d1ukla_, d1uklb_ |
PDB Entry: 1ukl (more details), 3 Å
SCOP Domain Sequences for d1uklc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens)} rssindkiielkdlvmgtdakmhksgvlrkaidyikylqqvnhklrqenmvlklanqknk l
Timeline for d1uklc_: