Lineage for d1ukla_ (1ukl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332749Protein Importin beta [48378] (3 species)
  7. 2332771Species Mouse (Mus musculus) [TaxId:10090] [48380] (2 PDB entries)
  8. 2332774Domain d1ukla_: 1ukl A: [99493]
    Other proteins in same PDB: d1uklc_, d1ukld_, d1ukle_, d1uklf_
    complexed with SREBP-2 HLH domain
    protein/DNA complex

Details for d1ukla_

PDB Entry: 1ukl (more details), 3 Å

PDB Description: Crystal structure of Importin-beta and SREBP-2 complex
PDB Compounds: (A:) importin beta-1 subunit

SCOPe Domain Sequences for d1ukla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukla_ a.118.1.1 (A:) Importin beta {Mouse (Mus musculus) [TaxId: 10090]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllstcce
ddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptlielmkdp
svvvrdttawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
yaeyqvclaavglvgdlcralqsnilpfcdevmqlllenlgnenvhrsvkpqilsvfgdi
alaiggefkkylevvlntlqqasqaqvdksdfdmvdylnelrescleaytgivqglkgdq
envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
pmihelltegrrsktnkaktlatwatkelrklknqa

SCOPe Domain Coordinates for d1ukla_:

Click to download the PDB-style file with coordinates for d1ukla_.
(The format of our PDB-style files is described here.)

Timeline for d1ukla_: