SCOP 1.75: Domain d1ukgb_: 1ukg B:

Lineage for d1ukgb_ (1ukg B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (30 PDB entries)

8. Domain d1ukgb_: 1ukg B: [99490]
   complexed with ca, mam, mn

Details for d1ukgb_

PDB Entry: 1ukg, 1.7 Å

PDB Description: pterocarps angolensis lectin pal in complex with methyl-alpha-mannose

PDB Compounds: (B:) lectin

SCOP Domain Sequences for d1ukgb_:

Sequence; same for both SEQRES and ATOM records:

>d1ukgb_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

Timeline for d1ukgb_:

• d1ukgb_ first appeared in SCOP 1.67
  
• d1ukgb_ appears in SCOP 1.73
  
• d1ukgb_ appears in SCOPe 2.01
  
• d1ukgb_ appears in the current release, SCOPe 2.08