Lineage for d1ukgb_ (1ukg B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794214Protein Legume lectin [49904] (23 species)
  7. 794218Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (30 PDB entries)
  8. 794220Domain d1ukgb_: 1ukg B: [99490]
    complexed with ca, mam, mn

Details for d1ukgb_

PDB Entry: 1ukg (more details), 1.7 Å

PDB Description: Pterocarps angolensis lectin PAL in complex with methyl-alpha-mannose
PDB Compounds: (B:) lectin

SCOP Domain Sequences for d1ukgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukgb_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOP Domain Coordinates for d1ukgb_:

Click to download the PDB-style file with coordinates for d1ukgb_.
(The format of our PDB-style files is described here.)

Timeline for d1ukgb_: