Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries) |
Domain d1ukga_: 1ukg A: [99489] complexed with ca, mma, mn |
PDB Entry: 1ukg (more details), 1.7 Å
SCOPe Domain Sequences for d1ukga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt a
Timeline for d1ukga_: