Lineage for d1ukfa1 (1ukf A:81-267)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174029Family d.3.1.10: Avirulence protein Avrpph3 [102723] (1 protein)
    automatically mapped to Pfam PF03543
  6. 2174030Protein Avirulence protein Avrpph3 [102724] (1 species)
  7. 2174031Species Pseudomonas syringae pv. phaseolicola [TaxId:319] [102725] (1 PDB entry)
  8. 2174032Domain d1ukfa1: 1ukf A:81-267 [99488]
    Other proteins in same PDB: d1ukfa2

Details for d1ukfa1

PDB Entry: 1ukf (more details), 1.35 Å

PDB Description: Crystal Structure of Pseudomonas Avirulence Protein AvrPphB
PDB Compounds: (A:) Avirulence protein AVRPPH3

SCOPe Domain Sequences for d1ukfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukfa1 d.3.1.10 (A:81-267) Avirulence protein Avrpph3 {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
slsdfsvasrdvnhnnicaglstewlvmssdgdaesrmdhldyngegqsrgserhqvynd
alraalsnddeapfftastaviedagfslrrepktvhasggsaqlgqtvahdvaqsgrkh
llslrfanvqghaiacscegsqfklfdpnlgefqssrsaapqlikglidhynslnydvac
vnefrvs

SCOPe Domain Coordinates for d1ukfa1:

Click to download the PDB-style file with coordinates for d1ukfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ukfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ukfa2