SCOPe 2.08: Domain d1uk3b_: 1uk3 B:

Lineage for d1uk3b_ (1uk3 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries)

8. Domain d1uk3b_: 1uk3 B: [99484]
   has additional subdomain(s) that are not in the common domain

Details for d1uk3b_

PDB Entry: 1uk3, 2.4 Å

PDB Description: Crystal structure of SARS Coronavirus Main Proteinase (3CLpro) At pH7.6

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d1uk3b_:

Sequence; same for both SEQRES and ATOM records:

>d1uk3b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sg

Timeline for d1uk3b_:

• d1uk3b_ first appeared in SCOP 1.67
  
• d1uk3b_ appears in SCOPe 2.07