Lineage for d1uk2b_ (1uk2 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2057913Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2057935Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)
  8. 2057995Domain d1uk2b_: 1uk2 B: [99482]

Details for d1uk2b_

PDB Entry: 1uk2 (more details), 2.2 Å

PDB Description: Crystal structure of SARS Coronavirus Main Proteinase (3CLpro) At pH8.0
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d1uk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk2b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sg

SCOPe Domain Coordinates for d1uk2b_:

Click to download the PDB-style file with coordinates for d1uk2b_.
(The format of our PDB-style files is described here.)

Timeline for d1uk2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uk2a_