Lineage for d1uk0b1 (1uk0 B:1-137)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355838Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 355839Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
  5. 355840Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 355841Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 355850Species Human (Homo sapiens) [TaxId:9606] [101198] (1 PDB entry)
  8. 355852Domain d1uk0b1: 1uk0 B:1-137 [99479]
    Other proteins in same PDB: d1uk0a2, d1uk0b2
    complexed with frm

Details for d1uk0b1

PDB Entry: 1uk0 (more details), 3 Å

PDB Description: Crystal structure of catalytic domain of human poly(ADP-ribose) polymerase with a novel inhibitor

SCOP Domain Sequences for d1uk0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk0b1 a.41.1.1 (B:1-137) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens)}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyeklk

SCOP Domain Coordinates for d1uk0b1:

Click to download the PDB-style file with coordinates for d1uk0b1.
(The format of our PDB-style files is described here.)

Timeline for d1uk0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uk0b2