SCOP 1.73: Domain d1uk0a1: 1uk0 A:1-137

Lineage for d1uk0a1 (1uk0 A:1-137)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family)
   duplication: consists of 2 helix-loop-helix structural repeats

5. Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)

6. Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101198] (3 PDB entries)

8. Domain d1uk0a1: 1uk0 A:1-137 [99477]
   Other proteins in same PDB: d1uk0a2, d1uk0b2

Details for d1uk0a1

PDB Entry: 1uk0, 3 Å

PDB Description: Crystal structure of catalytic domain of human poly(ADP-ribose) polymerase with a novel inhibitor

PDB Compounds: (A:) Poly [ADP-ribose] polymerase-1

SCOP Domain Sequences for d1uk0a1:

Sequence; same for both SEQRES and ATOM records:

>d1uk0a1 a.41.1.1 (A:1-137) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyeklk

Timeline for d1uk0a1:

• d1uk0a1 first appeared in SCOP 1.67
  
• d1uk0a1 appears in SCOP 1.71
  
• d1uk0a1 appears in SCOP 1.75
  
• d1uk0a1 appears in the current release, SCOPe 2.08