SCOPe 2.07: Domain d1ujza_: 1ujz A:

Lineage for d1ujza_ (1ujz A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d1ujza_: 1ujz A: [99475]
   Other proteins in same PDB: d1ujzb_
   computationally designed interface with the colicin E7 DNase domain

Details for d1ujza_

PDB Entry: 1ujz, 2.1 Å

PDB Description: crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein

PDB Compounds: (A:) Designed Colicin E7 immunity protein

SCOPe Domain Sequences for d1ujza_:

Sequence; same for both SEQRES and ATOM records:

>d1ujza_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvlyvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

Timeline for d1ujza_:

• d1ujza_ first appeared in SCOP 1.67
  
• d1ujza_ appears in SCOPe 2.06
  
• d1ujza_ appears in the current release, SCOPe 2.08