SCOPe 2.05: Domain d1ujya_: 1ujy A:

Lineage for d1ujya_ (1ujy A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Rac/CDC42 GEF 6 [101677] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101678] (1 PDB entry)

8. Domain d1ujya_: 1ujy A: [99474]

Details for d1ujya_

PDB Entry: 1ujy

PDB Description: solution structure of sh3 domain in rac/cdc42 guanine nucleotide exchange factor(gef) 6

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 6

SCOPe Domain Sequences for d1ujya_:

Sequence; same for both SEQRES and ATOM records:

>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgshqlivkarfnfkqtnedelsvckgdiiyvtrveeggwwegtlngrtgwfpsn
yvreikssersgpssg

Timeline for d1ujya_:

• d1ujya_ first appeared in SCOP 1.67
  
• d1ujya_ appears in SCOPe 2.04
  
• d1ujya_ is called d1ujya1 in SCOPe 2.06
  
• d1ujya_ appears in the current release, SCOPe 2.08, called d1ujya1