Lineage for d1ujya1 (1ujy A:8-70)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783213Protein Rac/CDC42 GEF 6 [101677] (1 species)
  7. 2783214Species Human (Homo sapiens) [TaxId:9606] [101678] (1 PDB entry)
  8. 2783215Domain d1ujya1: 1ujy A:8-70 [99474]
    Other proteins in same PDB: d1ujya2, d1ujya3

Details for d1ujya1

PDB Entry: 1ujy (more details)

PDB Description: solution structure of sh3 domain in rac/cdc42 guanine nucleotide exchange factor(gef) 6
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 6

SCOPe Domain Sequences for d1ujya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujya1 b.34.2.1 (A:8-70) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]}
shqlivkarfnfkqtnedelsvckgdiiyvtrveeggwwegtlngrtgwfpsnyvreiks
ser

SCOPe Domain Coordinates for d1ujya1:

Click to download the PDB-style file with coordinates for d1ujya1.
(The format of our PDB-style files is described here.)

Timeline for d1ujya1: