![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Rac/CDC42 GEF 6 [101677] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101678] (1 PDB entry) |
![]() | Domain d1ujya1: 1ujy A:8-70 [99474] Other proteins in same PDB: d1ujya2, d1ujya3 |
PDB Entry: 1ujy (more details)
SCOPe Domain Sequences for d1ujya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ujya1 b.34.2.1 (A:8-70) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} shqlivkarfnfkqtnedelsvckgdiiyvtrveeggwwegtlngrtgwfpsnyvreiks ser
Timeline for d1ujya1: