Lineage for d1ujxa_ (1ujx A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663035Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 663036Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) (S)
    has a few short helices inserted in loops
  5. 663070Family b.26.1.2: FHA domain [49885] (11 proteins)
  6. 663118Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species)
  7. 663121Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries)
  8. 663126Domain d1ujxa_: 1ujx A: [99473]

Details for d1ujxa_

PDB Entry: 1ujx (more details)

PDB Description: the forkhead associated (fha) domain like structure from mouse polynucleotide kinase 3'-phosphatase
PDB Compounds: (A:) polynucleotide kinase 3'-phosphatase

SCOP Domain Sequences for d1ujxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujxa_ b.26.1.2 (A:) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmsqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqvel
iadpesrtvavkqlgvnpstvgvqelkpglsgslslgdvlylvnglypltlrwsgpssg

SCOP Domain Coordinates for d1ujxa_:

Click to download the PDB-style file with coordinates for d1ujxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ujxa_: