SCOP 1.67: Domain d1ujxa_: 1ujx A:

Lineage for d1ujxa_ (1ujx A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (3 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (7 proteins)

6. Protein Polynucleotide kinase 3'-phosphatase [101628] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101629] (1 PDB entry)

8. Domain d1ujxa_: 1ujx A: [99473]

Details for d1ujxa_

PDB Entry: 1ujx

PDB Description: the forkhead associated (fha) domain like structure from mouse polynucleotide kinase 3'-phosphatase

SCOP Domain Sequences for d1ujxa_:

Sequence; same for both SEQRES and ATOM records:

>d1ujxa_ b.26.1.2 (A:) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus)}
gssgssgmsqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqvel
iadpesrtvavkqlgvnpstvgvqelkpglsgslslgdvlylvnglypltlrwsgpssg

Timeline for d1ujxa_:

• d1ujxa_ is new in SCOP 1.67
  
• d1ujxa_ appears in SCOP 1.69
  
• d1ujxa_ appears in the current release, SCOPe 2.08, called d1ujxa1