Lineage for d1ujxa1 (1ujx A:8-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778159Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species)
  7. 2778162Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries)
  8. 2778167Domain d1ujxa1: 1ujx A:8-113 [99473]
    Other proteins in same PDB: d1ujxa2, d1ujxa3

Details for d1ujxa1

PDB Entry: 1ujx (more details)

PDB Description: the forkhead associated (fha) domain like structure from mouse polynucleotide kinase 3'-phosphatase
PDB Compounds: (A:) polynucleotide kinase 3'-phosphatase

SCOPe Domain Sequences for d1ujxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujxa1 b.26.1.2 (A:8-113) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
msqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesr
tvavkqlgvnpstvgvqelkpglsgslslgdvlylvnglypltlrw

SCOPe Domain Coordinates for d1ujxa1:

Click to download the PDB-style file with coordinates for d1ujxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ujxa1: