Lineage for d1ujta_ (1ujt A:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (22 proteins) 
Protein KIAA1568 protein [101529] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101530] (2 PDB entries) 
Domain d1ujta_: 1ujt A: [99468]
structural genomics; second Fn3 module
Details for d1ujta_
PDB Entry: 1ujt (more details)
PDB Description: solution structure of the second fibronectin type iii domain of human kiaa1568 protein
SCOP Domain Sequences for d1ujta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens)}
gssgssgrqvqkelgdvlvrlhnpvvltpttvqvtwtvdrqpqfiqgyrvmyrqtsglqa
tsswqnldakvptersavlvnlkkgvtyeikvrpyfnefqgmdsesktvrtteesgpssg
SCOP Domain Coordinates for d1ujta_:
Click to download the PDB-style file with coordinates for d1ujta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ujta_:
- d1ujta_ is new in SCOP 1.67
- d1ujta_ appears in SCOP 1.69
- d1ujta_ appears in the current release, SCOPe 2.08, called d1ujta1
View in 3D