SCOPe 2.05: Domain d1ujsa_: 1ujs A:

Lineage for d1ujsa_ (1ujs A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
   3 short helices; irregular array

4. Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families)

5. Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)

6. Protein Actin-binding LIM protein homologue KIAA0843 [101101] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101102] (1 PDB entry)

8. Domain d1ujsa_: 1ujs A: [99467]

Details for d1ujsa_

PDB Entry: 1ujs

PDB Description: solution structure of the villin headpiece domain of human actin- binding lim protein homologue (kiaa0843 protein)

PDB Compounds: (A:) actin-binding LIM protein homologue

SCOPe Domain Sequences for d1ujsa_:

Sequence; same for both SEQRES and ATOM records:

>d1ujsa_ a.14.1.1 (A:) Actin-binding LIM protein homologue KIAA0843 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgnavnwgmreykiypyelllvttrgrnrlpkdvdrtrlerhlsqeefyqvfgmt
isefdrlalwkrnelkkqarlfsgpssg

Timeline for d1ujsa_:

• d1ujsa_ first appeared in SCOP 1.67
  
• d1ujsa_ appears in SCOPe 2.04
  
• d1ujsa_ is called d1ujsa1 in SCOPe 2.06
  
• d1ujsa_ appears in the current release, SCOPe 2.08, called d1ujsa1