Lineage for d1ujsa_ (1ujs A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352908Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 352909Superfamily a.14.1: VHP, Villin headpiece domain [47050] (1 family) (S)
  5. 352910Family a.14.1.1: VHP, Villin headpiece domain [47051] (3 proteins)
  6. 352911Protein Actin-binding LIM protein homologue KIAA0843 [101101] (1 species)
  7. 352912Species Human (Homo sapiens) [TaxId:9606] [101102] (1 PDB entry)
  8. 352913Domain d1ujsa_: 1ujs A: [99467]

Details for d1ujsa_

PDB Entry: 1ujs (more details)

PDB Description: solution structure of the villin headpiece domain of human actin- binding lim protein homologue (kiaa0843 protein)

SCOP Domain Sequences for d1ujsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujsa_ a.14.1.1 (A:) Actin-binding LIM protein homologue KIAA0843 {Human (Homo sapiens)}
gssgssgnavnwgmreykiypyelllvttrgrnrlpkdvdrtrlerhlsqeefyqvfgmt
isefdrlalwkrnelkkqarlfsgpssg

SCOP Domain Coordinates for d1ujsa_:

Click to download the PDB-style file with coordinates for d1ujsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ujsa_: