SCOPe 2.08: Domain d1ujsa1: 1ujs A:8-82

Lineage for d1ujsa1 (1ujs A:8-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
   3 short helices; irregular array

4. Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families)

5. Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)

6. Protein Actin-binding LIM protein homologue KIAA0843 [101101] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101102] (1 PDB entry)

8. Domain d1ujsa1: 1ujs A:8-82 [99467]
   Other proteins in same PDB: d1ujsa2, d1ujsa3

Details for d1ujsa1

PDB Entry: 1ujs

PDB Description: solution structure of the villin headpiece domain of human actin- binding lim protein homologue (kiaa0843 protein)

PDB Compounds: (A:) actin-binding LIM protein homologue

SCOPe Domain Sequences for d1ujsa1:

Sequence; same for both SEQRES and ATOM records:

>d1ujsa1 a.14.1.1 (A:8-82) Actin-binding LIM protein homologue KIAA0843 {Human (Homo sapiens) [TaxId: 9606]}
navnwgmreykiypyelllvttrgrnrlpkdvdrtrlerhlsqeefyqvfgmtisefdrl
alwkrnelkkqarlf

Timeline for d1ujsa1:

• d1ujsa1 first appeared in SCOP 1.67, called d1ujsa_
  
• d1ujsa1 appears in SCOPe 2.07