Lineage for d1ujqd_ (1ujq D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475982Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 476105Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
    forms a swapped dimer
  6. 476106Protein 2-methylisocitrate lyase [89499] (2 species)
  7. 476112Species Salmonella typhimurium [TaxId:90371] [102099] (2 PDB entries)
  8. 476116Domain d1ujqd_: 1ujq D: [99466]

Details for d1ujqd_

PDB Entry: 1ujq (more details), 2.1 Å

PDB Description: Crystal structure of 2-methylisocitrate lyase (PrpB) from Salmonella enterica serovar typhimurium

SCOP Domain Sequences for d1ujqd_:

Sequence, based on SEQRES records: (download)

>d1ujqd_ c.1.12.7 (D:) 2-methylisocitrate lyase {Salmonella typhimurium}
hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvgakrc
ghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayvdagad
mlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalyplsafram
nraaekvytvlrqegtqknvidimqtrnelyesinyyqf

Sequence, based on observed residues (ATOM records): (download)

>d1ujqd_ c.1.12.7 (D:) 2-methylisocitrate lyase {Salmonella typhimurium}
hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
rqegtqknvidimqtrnelyesinyyqf

SCOP Domain Coordinates for d1ujqd_:

Click to download the PDB-style file with coordinates for d1ujqd_.
(The format of our PDB-style files is described here.)

Timeline for d1ujqd_: