Lineage for d1ujqd_ (1ujq D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088212Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 protein domains)
    forms a swapped dimer
  6. 2088213Protein 2-methylisocitrate lyase [89499] (2 species)
  7. 2088227Species Salmonella typhimurium [TaxId:90371] [102099] (2 PDB entries)
  8. 2088231Domain d1ujqd_: 1ujq D: [99466]

Details for d1ujqd_

PDB Entry: 1ujq (more details), 2.1 Å

PDB Description: Crystal structure of 2-methylisocitrate lyase (PrpB) from Salmonella enterica serovar typhimurium
PDB Compounds: (D:) Probable methylisocitrate lyase

SCOPe Domain Sequences for d1ujqd_:

Sequence, based on SEQRES records: (download)

>d1ujqd_ c.1.12.7 (D:) 2-methylisocitrate lyase {Salmonella typhimurium [TaxId: 90371]}
hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvgakrc
ghrpnkaivskeemvdriraavdartdpnfvimartdalavegleaaldraqayvdagad
mlfpeaitelsmyrrfadvaqvpilanitefgatplfttdelrsahvamalyplsafram
nraaekvytvlrqegtqknvidimqtrnelyesinyyqf

Sequence, based on observed residues (ATOM records): (download)

>d1ujqd_ c.1.12.7 (D:) 2-methylisocitrate lyase {Salmonella typhimurium [TaxId: 90371]}
hspgqafraalakenplqivgainanhallaqragyqaiylsgggvaagslglpdlgist
lddvltdirritdvcplpllvdadigfgssafnvartvksiakagaaalhiedqvaivsk
eemvdriraavdartdpnfvimartdalavegleaaldraqayvdagadmlfpeaitels
myrrfadvaqvpilanitefgatplfttdelrsahvamalyplsaframnraaekvytvl
rqegtqknvidimqtrnelyesinyyqf

SCOPe Domain Coordinates for d1ujqd_:

Click to download the PDB-style file with coordinates for d1ujqd_.
(The format of our PDB-style files is described here.)

Timeline for d1ujqd_: