Lineage for d1ujpa_ (1ujp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079695Species Thermus thermophilus [TaxId:274] [102038] (1 PDB entry)
  8. 2079696Domain d1ujpa_: 1ujp A: [99462]
    complexed with cit

Details for d1ujpa_

PDB Entry: 1ujp (more details), 1.34 Å

PDB Description: Crystal Structure of Tryptophan Synthase A-Subunit From Thermus thermophilus HB8
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1ujpa_:

Sequence, based on SEQRES records: (download)

>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]}
mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdplgdgp
viqraselalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqaga
tgvilpdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsvtgvt
gmrerlpeevkdlvrrikartalpvavgfgvsgkataaqaavadgvvvgsalvraleegr
slapllqeirqglqrleanpglkesskkplp

Sequence, based on observed residues (ATOM records): (download)

>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]}
mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdgpviqr
aselalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqagatgvi
lpdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsvevkdlvrr
ikartalpvavgfgvsgkataaqaavadgvvvgsalvraleegrslapllqeirqglqrl
plp

SCOPe Domain Coordinates for d1ujpa_:

Click to download the PDB-style file with coordinates for d1ujpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ujpa_: