Lineage for d1ujnb_ (1ujn B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953870Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1953871Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1953872Family e.22.1.1: Dehydroquinate synthase, DHQS [56797] (1 protein)
  6. 1953873Protein Dehydroquinate synthase, DHQS [56798] (2 species)
  7. 1953898Species Thermus thermophilus [TaxId:274] [103402] (1 PDB entry)
  8. 1953900Domain d1ujnb_: 1ujn B: [99461]

Details for d1ujnb_

PDB Entry: 1ujn (more details), 1.8 Å

PDB Description: Crystal structure of dehydroquinate synthase from Thermus thermophilus HB8
PDB Compounds: (B:) dehydroquinate synthase

SCOPe Domain Sequences for d1ujnb_:

Sequence, based on SEQRES records: (download)

>d1ujnb_ e.22.1.1 (B:) Dehydroquinate synthase, DHQS {Thermus thermophilus [TaxId: 274]}
mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpyllr
dkkkvseslhwvvplapgrlvvrplpegllreafaawreelkglgllr

Sequence, based on observed residues (ATOM records): (download)

>d1ujnb_ e.22.1.1 (B:) Dehydroquinate synthase, DHQS {Thermus thermophilus [TaxId: 274]}
mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
alphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpylslhwv
vplapgrlvvrplpegllreafaawreelkglgllr

SCOPe Domain Coordinates for d1ujnb_:

Click to download the PDB-style file with coordinates for d1ujnb_.
(The format of our PDB-style files is described here.)

Timeline for d1ujnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ujna_