Lineage for d1ujna_ (1ujn A:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 518596Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 518597Superfamily e.22.1: Dehydroquinate synthase-like [56796] (2 families) (S)
  5. 518598Family e.22.1.1: Dehydroquinate synthase, DHQS [56797] (1 protein)
  6. 518599Protein Dehydroquinate synthase, DHQS [56798] (2 species)
  7. 518624Species Thermus thermophilus [TaxId:274] [103402] (1 PDB entry)
  8. 518625Domain d1ujna_: 1ujn A: [99460]

Details for d1ujna_

PDB Entry: 1ujn (more details), 1.8 Å

PDB Description: Crystal structure of dehydroquinate synthase from Thermus thermophilus HB8

SCOP Domain Sequences for d1ujna_:

Sequence, based on SEQRES records: (download)

>d1ujna_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Thermus thermophilus}
mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpyllr
dkkkvseslhwvvplapgrlvvrplpegllreafaawreelkglgll

Sequence, based on observed residues (ATOM records): (download)

>d1ujna_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Thermus thermophilus}
mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpylsl
hwvvplapgrlvvrplpegllreafaawreelkglgll

SCOP Domain Coordinates for d1ujna_:

Click to download the PDB-style file with coordinates for d1ujna_.
(The format of our PDB-style files is described here.)

Timeline for d1ujna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ujnb_