SCOPe 2.08: Domain d1ujla_: 1ujl A:

Lineage for d1ujla_ (1ujl A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.12: Inactivation gate of potassium and sodium channels [58358] (1 superfamily)

4. Superfamily j.12.1: Inactivation gate of potassium and sodium channels [58359] (1 family)

5. Family j.12.1.1: Inactivation gate of potassium and sodium channels [58360] (4 proteins)
   it is not a true family

6. Protein Potassium voltage-gated channel subfamily H (HERG) extracellular linker [103710] (1 species)

7. Species Synthetic, based on human sequence [103711] (1 PDB entry)

8. Domain d1ujla_: 1ujl A: [99459]

Details for d1ujla_

PDB Entry: 1ujl

PDB Description: solution structure of the herg k+ channel s5-p extracellular linker

PDB Compounds: (A:) Potassium voltage-gated channel subfamily H member 2

SCOPe Domain Sequences for d1ujla_:

Sequence; same for both SEQRES and ATOM records:

>d1ujla_ j.12.1.1 (A:) Potassium voltage-gated channel subfamily H (HERG) extracellular linker {Synthetic, based on human sequence}
aignmeqphmdsrigwlhnlgdqigkpynssglggpsikdky

Timeline for d1ujla_:

• d1ujla_ first appeared in SCOP 1.67
  
• d1ujla_ appears in SCOPe 2.07