Lineage for d1ujla_ (1ujl A:)

  1. Root: SCOPe 2.08
  2. Class j: Peptides [58231] (151 folds)
  3. Fold j.12: Inactivation gate of potassium and sodium channels [58358] (1 superfamily)
  4. Superfamily j.12.1: Inactivation gate of potassium and sodium channels [58359] (1 family) (S)
  5. Family j.12.1.1: Inactivation gate of potassium and sodium channels [58360] (4 proteins)
    it is not a true family
  6. Protein Potassium voltage-gated channel subfamily H (HERG) extracellular linker [103710] (1 species)
  7. Species Synthetic, based on human sequence [103711] (1 PDB entry)
  8. Domain d1ujla_: 1ujl A: [99459]

Details for d1ujla_

PDB Entry: 1ujl (more details)

PDB Description: Solution Structure of the HERG K+ channel S5-P extracellular linker
PDB Compounds: (A:) Potassium voltage-gated channel subfamily H member 2

SCOPe Domain Sequences for d1ujla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujla_ j.12.1.1 (A:) Potassium voltage-gated channel subfamily H (HERG) extracellular linker {Synthetic, based on human sequence}
aignmeqphmdsrigwlhnlgdqigkpynssglggpsikdky

SCOPe Domain Coordinates for d1ujla_ are not available.

Timeline for d1ujla_: