Lineage for d1ujkb_ (1ujk B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 360073Superfamily a.118.9: ENTH/VHS domain [48464] (3 families) (S)
  5. 360082Family a.118.9.2: VHS domain [48468] (5 proteins)
  6. 360083Protein ADP-ribosylation factor binding protein Gga1 [74782] (1 species)
  7. 360084Species Human (Homo sapiens) [TaxId:9606] [74783] (5 PDB entries)
  8. 360086Domain d1ujkb_: 1ujk B: [99458]
    complexed with beta-secretase C-terminal phosphopeptide
    complexed with iod

Details for d1ujkb_

PDB Entry: 1ujk (more details), 1.9 Å

PDB Description: VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE

SCOP Domain Sequences for d1ujkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujkb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens)}
petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
peevkiaeayqmlkkqgivk

SCOP Domain Coordinates for d1ujkb_:

Click to download the PDB-style file with coordinates for d1ujkb_.
(The format of our PDB-style files is described here.)

Timeline for d1ujkb_: