| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (3 families) ![]() |
| Family a.118.9.2: VHS domain [48468] (5 proteins) |
| Protein ADP-ribosylation factor binding protein Gga1 [74782] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [74783] (5 PDB entries) |
| Domain d1ujkb_: 1ujk B: [99458] complexed with beta-secretase C-terminal phosphopeptide complexed with iod |
PDB Entry: 1ujk (more details), 1.9 Å
SCOP Domain Sequences for d1ujkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ujkb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens)}
petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
peevkiaeayqmlkkqgivk
Timeline for d1ujkb_: