SCOP 1.67: Domain d1ujjb_: 1ujj B:

Lineage for d1ujjb_ (1ujj B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (3 families)

5. Family a.118.9.2: VHS domain [48468] (5 proteins)

6. Protein ADP-ribosylation factor binding protein Gga1 [74782] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74783] (5 PDB entries)

8. Domain d1ujjb_: 1ujj B: [99456]
   complexed with beta-secretase C-terminal phosphopeptide

Details for d1ujjb_

PDB Entry: 1ujj, 2.6 Å

PDB Description: VHS domain of human GGA1 complexed with C-terminal peptide from BACE

SCOP Domain Sequences for d1ujjb_:

Sequence; same for both SEQRES and ATOM records:

>d1ujjb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens)}
petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
peevkiaeayqmlkkqgivk

Timeline for d1ujjb_:

• d1ujjb_ is new in SCOP 1.67
  
• d1ujjb_ appears in SCOP 1.69
  
• d1ujjb_ appears in the current release, SCOPe 2.08