Lineage for d1ujjb_ (1ujj B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. Protein ADP-ribosylation factor binding protein Gga1 [74782] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [74783] (5 PDB entries)
  8. Domain d1ujjb_: 1ujj B: [99456]
    complexed with beta-secretase C-terminal phosphopeptide

Details for d1ujjb_

PDB Entry: 1ujj (more details), 2.6 Å

PDB Description: VHS domain of human GGA1 complexed with C-terminal peptide from BACE
PDB Compounds: (B:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1ujjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujjb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
peevkiaeayqmlkkqgivk

SCOPe Domain Coordinates for d1ujjb_ are not available.

Timeline for d1ujjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ujja_