SCOP 1.67: Domain d1uj2a_: 1uj2 A:

Lineage for d1uj2a_ (1uj2 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (5 proteins)

6. Protein Uridine-cytidine kinase 2 [102360] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102361] (5 PDB entries)

8. Domain d1uj2a_: 1uj2 A: [99452]

Details for d1uj2a_

PDB Entry: 1uj2, 1.8 Å

PDB Description: Crystal structure of human uridine-cytidine kinase 2 complexed with products, CMP and ADP

SCOP Domain Sequences for d1uj2a_:

Sequence; same for both SEQRES and ATOM records:

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens)}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdilng

Timeline for d1uj2a_:

• d1uj2a_ is new in SCOP 1.67
  
• d1uj2a_ appears in SCOP 1.69
  
• d1uj2a_ appears in the current release, SCOPe 2.08