Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (5 species) contains an extra alpha-helical domain |
Species SARS coronavirus [TaxId:227859] [89349] (55 PDB entries) |
Domain d1uj1b_: 1uj1 B: [99451] |
PDB Entry: 1uj1 (more details), 1.9 Å
SCOPe Domain Sequences for d1uj1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj1b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc sg
Timeline for d1uj1b_: