Lineage for d1uj0a_ (1uj0 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783767Protein Signal transducing adaptor molecule Stam2 [101675] (1 species)
  7. 1783768Species Mouse (Mus musculus) [TaxId:10090] [101676] (1 PDB entry)
  8. 1783769Domain d1uj0a_: 1uj0 A: [99449]
    complexed with a ubpy-derived peptide
    complexed with po4

Details for d1uj0a_

PDB Entry: 1uj0 (more details), 1.7 Å

PDB Description: Crystal Structure of STAM2 SH3 domain in complex with a UBPY-derived peptide
PDB Compounds: (A:) signal transducing adaptor molecule (SH3 domain and ITAM motif) 2

SCOPe Domain Sequences for d1uj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]}
marrvralydfeavedneltfkhgelitvlddsdanwwqgenhrgtglfpsnfvttdl

SCOPe Domain Coordinates for d1uj0a_:

Click to download the PDB-style file with coordinates for d1uj0a_.
(The format of our PDB-style files is described here.)

Timeline for d1uj0a_: