SCOPe 2.08: Domain d1uj0a1: 1uj0 A:204-260

Lineage for d1uj0a1 (1uj0 A:204-260)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Signal transducing adaptor molecule Stam2 [101675] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101676] (1 PDB entry)

8. Domain d1uj0a1: 1uj0 A:204-260 [99449]
   Other proteins in same PDB: d1uj0a2
   complexed with a ubpy-derived peptide
   complexed with po4

Details for d1uj0a1

PDB Entry: 1uj0, 1.7 Å

PDB Description: Crystal Structure of STAM2 SH3 domain in complex with a UBPY-derived peptide

PDB Compounds: (A:) signal transducing adaptor molecule (SH3 domain and ITAM motif) 2

SCOPe Domain Sequences for d1uj0a1:

Sequence; same for both SEQRES and ATOM records:

>d1uj0a1 b.34.2.1 (A:204-260) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]}
arrvralydfeavedneltfkhgelitvlddsdanwwqgenhrgtglfpsnfvttdl

Timeline for d1uj0a1:

• d1uj0a1 first appeared in SCOP 1.67, called d1uj0a_
  
• d1uj0a1 appears in SCOPe 2.07