SCOP 1.75: Domain d1uiya_: 1uiy A:

Lineage for d1uiya_ (1uiy A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102207] (1 PDB entry)

8. Domain d1uiya_: 1uiy A: [99448]
   complexed with dox, gol

Details for d1uiya_

PDB Entry: 1uiy, 2.85 Å

PDB Description: crystal structure of enoyl-coa hydratase from thermus thermophilus hb8

PDB Compounds: (A:) enoyl-coa hydratase

SCOP Domain Sequences for d1uiya_:

Sequence; same for both SEQRES and ATOM records:

>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]}
mvqvekghvavvflndperrnplspemalsllqalddleadpgvravvltgrgkafsaga
dlaflervtelgaeenyrhslslmrlfhrvytypkptvaavngpavaggaglalacdlvv
mdeearlgytevkigfvaalvsvilvravgekaakdllltgrlveareakalglvnriap
pgkaleeakalaeevaknaptslrltkelllalpgmgledgfrlaalanawvretgdlae
giraffekrpprf

Timeline for d1uiya_:

• d1uiya_ first appeared in SCOP 1.67
  
• d1uiya_ appears in SCOP 1.73
  
• d1uiya_ appears in SCOPe 2.01
  
• d1uiya_ appears in the current release, SCOPe 2.08