SCOPe 2.05: Domain d1uivb_: 1uiv B:

Lineage for d1uivb_ (1uiv B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102695] (18 PDB entries)

8. Domain d1uivb_: 1uiv B: [99437]
   complexed with ni

Details for d1uivb_

PDB Entry: 1uiv, 1.95 Å

PDB Description: crystal structures of the liganded and unliganded nickel binding protein nika from escherichia coli (nickel liganded form)

PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d1uivb_:

Sequence; same for both SEQRES and ATOM records:

>d1uivb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiirad
mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
pyapiateipfeqikp

Timeline for d1uivb_:

• d1uivb_ first appeared in SCOP 1.67
  
• d1uivb_ appears in SCOPe 2.04
  
• d1uivb_ appears in SCOPe 2.06
  
• d1uivb_ appears in the current release, SCOPe 2.08