Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein Nickel-binding periplasmic protein NikA [102694] (1 species) similar domain organization to oligo- and dipeptide-binding protein |
Species Escherichia coli [TaxId:562] [102695] (14 PDB entries) |
Domain d1uiva_: 1uiv A: [99436] complexed with ni |
PDB Entry: 1uiv (more details), 1.95 Å
SCOPe Domain Sequences for d1uiva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uiva_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]} deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiirad mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni pyapiateipfeqikpv
Timeline for d1uiva_: