Lineage for d1uiva_ (1uiv A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009147Protein Nickel-binding periplasmic protein NikA [102694] (1 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 1009148Species Escherichia coli [TaxId:562] [102695] (14 PDB entries)
  8. 1009163Domain d1uiva_: 1uiv A: [99436]
    complexed with ni

Details for d1uiva_

PDB Entry: 1uiv (more details), 1.95 Å

PDB Description: crystal structures of the liganded and unliganded nickel binding protein nika from escherichia coli (nickel liganded form)
PDB Compounds: (A:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d1uiva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uiva_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiirad
mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
pyapiateipfeqikpv

SCOPe Domain Coordinates for d1uiva_:

Click to download the PDB-style file with coordinates for d1uiva_.
(The format of our PDB-style files is described here.)

Timeline for d1uiva_: