Lineage for d1uita1 (1uit A:8-111)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056370Protein Discs large 5 protein KIAA0583 [101725] (1 species)
  7. 2056371Species Human (Homo sapiens) [TaxId:9606] [101726] (1 PDB entry)
  8. 2056372Domain d1uita1: 1uit A:8-111 [99433]
    Other proteins in same PDB: d1uita2, d1uita3
    structural genomics; Rsgi Ruh-006 domain

Details for d1uita1

PDB Entry: 1uit (more details)

PDB Description: solution structure of rsgi ruh-006, the third pdz domain of hdlg5 (kiaa0583) protein [homo sapiens]
PDB Compounds: (A:) human discs large 5 protein

SCOPe Domain Sequences for d1uita1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uita1 b.36.1.1 (A:8-111) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]}
gerrkdrpyveeprhvkvqkgseplgisivsgekggiyvskvtvgsiahqagleygdqll
efnginlrsateqqarliigqqcdtitilaqynphvhqlsshsr

SCOPe Domain Coordinates for d1uita1:

Click to download the PDB-style file with coordinates for d1uita1.
(The format of our PDB-style files is described here.)

Timeline for d1uita1: